PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00124299001
Common NameGSBRNA2T00124299001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 387aa    MW: 42620.1 Da    PI: 9.0018
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00124299001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.61.4e-38122181261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k+l+cprC+s+ntkfCyynny++sqPryfC++C+ryWt+GG++rnvPvG+grrknk +
  GSBRNA2T00124299001 122 PDKILPCPRCESANTKFCYYNNYNVSQPRYFCRNCQRYWTAGGSMRNVPVGSGRRKNKGW 181
                          7899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-30119179IPR003851Zinc finger, Dof-type
PfamPF027017.8E-32124179IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.546126180IPR003851Zinc finger, Dof-type
PROSITE patternPS013610128164IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MSKSRDIKLF GTTITSLSAV NHYDPSPLSA AHGGSDQSKE ASSSSSSSCS PSIRPDRVLA  60
DKNEQESSRF KDPYTLSHLN EPPKAASEIL SPLSSKTNTD QQSELTTTST SAADKPTTLK  120
KPDKILPCPR CESANTKFCY YNNYNVSQPR YFCRNCQRYW TAGGSMRNVP VGSGRRKNKG  180
WPSSNHYLHV TSEDYENNNN LGTILSFGSS ESSVTETGKH QPGDTKITAD SASQQHQTGQ  240
GFLPPQVMFP NNSSPWPYQW SPAGPNANFY PIPFYWGCTV PVWPTSETPT CLGKRSRDQT  300
QGGGMRDASI TTRERLVSET LSISEVTKTA VWSPKPERKT EGFSLFNGFE TKGSNRRSFV  360
PETSINLQAN PAAMSRSMNF RENMQQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00223DAPTransfer from AT1G69570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00124299001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534820.0AK353482.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-45-E10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104997.10.0PREDICTED: cyclic dof factor 5
SwissprotQ9SEZ30.0CDF5_ARATH; Cyclic dof factor 5
TrEMBLA0A078F3070.0A0A078F307_BRANA; BnaA07g24230D protein
TrEMBLM4CIG00.0M4CIG0_BRARP; Uncharacterized protein
STRINGBra003994.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM130901729
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69570.10.0Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]